Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeTelangana 2014RANGAREDDYMAHESWARAMP.KISHTAMMA(Criminal & Asset Declaration)

Telangana 2014

P.KISHTAMMA

MAHESWARAM (RANGAREDDY)
Party:BSP
S/o|D/o|W/o: P. Lakhman
Age: 51
Name Enrolled as Voter in: Maheswaram (Arunachal Pradesh) constituency, at Serial no 340 in Part no 23

Self Profession:Retired Employee
Spouse Profession:

Crime-O-Meter


No criminal cases

Assets & Liabilities


Assets: Rs 27,50,000 ~27 Lacs+
Liabilities: Nil

Educational Details


Category: 8th Pass
9th class

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfYNoneRs 0 ~
spouseNil
dependent1Nil
dependent2Nil
dependent3Nil
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

No criminal cases

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousedependent1dependent2dependent3
iCash 50,000  50 Thou+

NilNilNilNil Rs 50,000
50 Thou+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial Companies 7,00,000  7 Lacs+

NilNilNilNil Rs 7,00,000
7 Lacs+
iiiBonds, Debentures and Shares in companiesNilNilNilNilNil Nil
iv(a)
NSS, Postal Savings etc
NilNilNilNilNil Nil
(b)
LIC or other insurance Policies
NilNilNilNilNil Nil
vPersonal loans/advance given NilNilNilNilNil Nil
viMotor Vehicles (details of make, etc.)NilNilNilNilNil Nil
viiJewellery (give details weight value)NilNilNilNilNil Nil
viiiOther assets, such as values of claims / interestsNilNilNilNilNil Nil
Gross Total Value (as per Affidavit) 7,50,000  7 Lacs+ Nil Nil Nil Nil Rs 7,50,000
7 Lacs+
Totals (Calculated as Sum of Values) Rs 7,50,000
7 Lacs+
Nil
Nil
Nil
Nil
Rs 7,50,000
7 Lacs+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousedependent1dependent2dependent3
iAgricultural LandNilNilNilNilNil Nil
iiNon Agricultural LandNilNilNilNilNil Nil
iiiCommercial BuildingsNilNilNilNilNil Nil
ivResidential Buildings9/1
Total Area 130 Sq.Y
Built Up Area 1000 Sft
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 60000.00
Development Cost 0.00
20,00,000  20 Lacs+

NilNilNilNil Rs 20,00,000
20 Lacs+
vOthersNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) Nil Nil Nil Nil Nil Nil
Totals Calculated Rs 20,00,000
20 Lacs+
Nil
Nil
Nil
Nil
Rs 20,00,000
20 Lacs+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousedependent1dependent2dependent3
iLoans from Banks / FIsNilNilNilNilNil Nil
Loans due to Individual / EntityNilNilNilNilNil Nil
Any other LiabilityNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) Nil Nil Nil Nil Nil Nil
iiDues to departments dealing with government accommodationNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Nil
Nil
Nil
Nil
Nil
Nil

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Name
Email
Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.




Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs